SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568182465|ref|YP_008955089.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568182465|ref|YP_008955089.1|
Domain Number 1 Region: 291-426
Classification Level Classification E-value
Superfamily CBS-domain pair 9.32e-20
Family CBS-domain pair 0.0034
Further Details:      
 
Domain Number 2 Region: 439-518
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 1.74e-16
Family CorC/HlyC domain-like 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|568182465|ref|YP_008955089.1|
Sequence length 523
Comment membrane protein [Pseudomonas monteilii SB3078]
Sequence
MEWLADPTAWLGLLTLIVLELVLGIDNLVFIAILADKLPPHQRDRARVIGLSLALIMRLG
LLASISWMVTLTAPLFEVFEKSFSGRDLIMLFGGVFLLFKATMELHERLEGHVAQASGTV
RHAAFWPIVAQIVVLDAVFSLDAVITAVGMVEQLSVMMIAVIFSIGIMIVASKPLTRFVN
AHPTVIMLCLGFLMMIGFSLTAEGLGFHIPKGYLYAAIGFSILIELFNQLARARRKRSLQ
QHRPLRERTAHAVLRLLGGRRVEADEVGEEIADLVEGGEEQVLFDRRERVMISGVLNLAE
RPIRTVMTARAEVDVIDLAQPADAIAQALANSPYSRLPLIRDGRVDEPLGFVHKKELLKE
LLSGNQPDLEGIARVPLNLLESFSILNALEQMRGQSTHIAFVVNEFGDFTGLLTMTDILE
SIAGELPDASEVEGPGIVQEGEGFVVSGALNLSQVQARTGFCARATEDYQTLAGLVMSLL
DRLPMVGDRLAWNGWTLTVEAVEERRVRQVRLTPNGDVDAAGA
Download sequence
Identical sequences V9V3D0
gi|568187843|ref|YP_008960457.1| gi|568182465|ref|YP_008955089.1| WP_024087203.1.23948 WP_024087203.1.28354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]