SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568182518|ref|YP_008955146.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568182518|ref|YP_008955146.1|
Domain Number 1 Region: 14-196
Classification Level Classification E-value
Superfamily ClpP/crotonase 8.19e-19
Family Biotin dependent carboxylase carboxyltransferase domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|568182518|ref|YP_008955146.1|
Sequence length 263
Comment malonate decarboxylase subunit gamma [Pseudomonas monteilii SB3078]
Sequence
MNRALNWLPGLAGGQALPGYPASLRVIDGELDNRLARFIAVVPDTDNPFPRARSGEVGLL
EGWGLAKAVSEAVEADRHGQKRAIVAVIDVPSQAYGRREEALGIHQALAAAVQAYAQARL
AGHPVIGLLVGKAMSGAFLAHGYQAQRLIALDDAGVMVHAMGKAAAARITLRSVEQLEAL
AAEVPPMAYDLASYASLGLLWRRLTVDNAETPSSADIAQVRACLADAVRDIGSSSDLSSR
LAGENRSASRQVREQLRRQWQGA
Download sequence
Identical sequences V9V265
WP_024087232.1.23948 WP_024087232.1.28354 WP_024087232.1.7288 gi|568182518|ref|YP_008955146.1| gi|568187896|ref|YP_008960514.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]