SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568182529|ref|YP_008955157.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|568182529|ref|YP_008955157.1|
Domain Number - Region: 16-158
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 0.00157
Family FMN-linked oxidoreductases 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|568182529|ref|YP_008955157.1|
Sequence length 666
Comment protease [Pseudomonas monteilii SB3078]
Sequence
MSLPKNHLELLSPARDVAIAREAILHGADAIYIGGPSFGARHNACNEVSDIAELVEFAHR
YHARVFTTINTILHDNELEPARKLIHQLYDAGVDALIVQDLGVMELDIPPIELHASTQTD
IRTLERARFLDQAGFSQLVLARELNLQQIRAIAAETDAAIEFFIHGALCVAFSGQCNISH
AQTGRSANRGDCSQACRLPYTLKDDQGRVVAFEKHLLSMKDNNQTANLADLVDAGVRSFK
IEGRYKDVAYVKNITAHYRKELDAILEGRPELARASSGRTQHFFVPDPDKTFHRGSTDYF
VTDRKVDIGAFDSPTFTGLPVGVVEKVGKRDMQVVTEVPLTNGDGLNVLLKREVVGFRAN
IAEPRGEFEEDGEKRYRYRVEPNEMPEGLHKLRPNHPLSRNLDHNWQQALQRTSAERRVG
VQWHAVLREQRLVLTVTSEEGVGTQVALEGPFGPANKPQQALDQLHDLLGQLGTTMYHAD
SIELDAPQAYFIPNSQLKALRREAIEALTAARVQAHPRGGRKAETTPPPVYPESHLSFLA
NVYNQKARDFYHRHGVQLIDAAYEAHEEHGEVPVMITKHCLRFSFNLCPKQAKGVTGVRT
KVAPMQLIQGDEVLTLKFDCKPCEMHVIGKMKSHIIDLPTPGSAVAQVVGHISPEDLLKT
IPRGPH
Download sequence
Identical sequences A0A099N282 V7D8H5 V9UYX2
gi|568182529|ref|YP_008955157.1| WP_023662522.1.23948 WP_023662522.1.28354 WP_023662522.1.56258 WP_023662522.1.7288 WP_023662522.1.80759 gi|568187907|ref|YP_008960525.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]