SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568182568|ref|YP_008955197.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568182568|ref|YP_008955197.1|
Domain Number 1 Region: 97-222
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 6.47e-32
Family Tetracyclin repressor-like, C-terminal domain 0.0088
Further Details:      
 
Domain Number 2 Region: 18-95
Classification Level Classification E-value
Superfamily Homeodomain-like 7.18e-18
Family Tetracyclin repressor-like, N-terminal domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|568182568|ref|YP_008955197.1|
Sequence length 227
Comment TetR family transcriptional regulator [Pseudomonas monteilii SB3078]
Sequence
MSDSVVSLGQPETEGGRKTRKNNPEKTREDILQAAINEFVQQGLAGARVDAIAERTATSK
RMIYYYFGSKEQLYCECLIKLYGDIRKTEQSLDLESLPAEQAIRRLVEFTFDHHDRNVDF
VRIICTENIHYGEYVKQSPAIREMSSLVLEALGNTLRRGVQEGVFRTGIEVIDLHMLMSS
FCFYRVSNRHTFGEIFQIDLSDEQVKLRHKAMICDAVLRYIQTEHRP
Download sequence
Identical sequences A0A059V2K3 A0A099N2B5 A0A0C1KQ92 A0A136QEC5 L0FIV7 V7D5T1 V9V2B1
gi|568187946|ref|YP_008960565.1| gi|568182568|ref|YP_008955197.1| gi|431802939|ref|YP_007229842.1| 2035999242 WP_015270640.1.1643 WP_015270640.1.23948 WP_015270640.1.28354 WP_015270640.1.35335 WP_015270640.1.56258 WP_015270640.1.57632 WP_015270640.1.65739 WP_015270640.1.71677 WP_015270640.1.7288 WP_015270640.1.7435 WP_015270640.1.80759 WP_015270640.1.95946

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]