SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568182605|ref|YP_008955234.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568182605|ref|YP_008955234.1|
Domain Number 1 Region: 145-280
Classification Level Classification E-value
Superfamily PR-1-like 1.33e-21
Family PR-1-like 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|568182605|ref|YP_008955234.1|
Sequence length 283
Comment Allergen V5/Tpx-1 family protein [Pseudomonas monteilii SB3078]
Sequence
MRVLSSVAALSLGLVVSVGAMAATGEEAQLIDSINVYRSKAQPCGGEASLELPPLNSDTR
LALSPEGTRDLQQAMTRAAYPMVNVQAISLSGPRDARAAMHAIEESFCQVVLDPQFVDIG
VSQEGRDWRIVLARPLLSGRLGDWQAEGQKVLQEINAARKVPRQCGGQPFAAAPALSWST
VLAGVAASHTRAMANQNFFDHIDKDGRTPGDRAELAGYLYQQIGENIAAGRDTARKVVDG
WLDSPGHCATLMNPDFRELGAAYAVDPKSDAGIYWTGLFGTPQ
Download sequence
Identical sequences A0A059UZ27 A0A099N0C6 V9V3R5
gi|568182605|ref|YP_008955234.1| gi|568187983|ref|YP_008960602.1| WP_024087273.1.23948 WP_024087273.1.28354 WP_024087273.1.35335 WP_024087273.1.56258 WP_024087273.1.65739 WP_024087273.1.7288 WP_024087273.1.80759

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]