SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568182650|ref|YP_008955281.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|568182650|ref|YP_008955281.1|
Domain Number - Region: 52-153
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.00248
Family Multidrug resistance efflux transporter EmrE 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|568182650|ref|YP_008955281.1|
Sequence length 172
Comment membrane protein [Pseudomonas monteilii SB3078]
Sequence
MFSKTLCLLVLPFALALLAGAVLPFQAAGNAAVGRALGHWLWGAFTSLTVSSLVVIFALL
ILRVPAPDMSKALQGPWWLWVGGVLGALYVAGAAALTPRLGAAGFLVLVVAGQIITAVVA
DHFGVMGLGGKPLNLARLAGVVLILCGVLLVQGTWAAGTPASATAVEKQSEG
Download sequence
Identical sequences A0A059UTD8 A0A099N2J3 V7DA04 V9V3V6
WP_023661742.1.23948 WP_023661742.1.28354 WP_023661742.1.35335 WP_023661742.1.65739 WP_023661742.1.7288 WP_023661742.1.80759 gi|568188028|ref|YP_008960649.1| gi|568182650|ref|YP_008955281.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]