SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568182672|ref|YP_008955303.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568182672|ref|YP_008955303.1|
Domain Number 1 Region: 117-289
Classification Level Classification E-value
Superfamily Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain 1.8e-36
Family GAPDH-like 0.00052
Further Details:      
 
Domain Number 2 Region: 6-139
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.12e-31
Family Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|568182672|ref|YP_008955303.1|
Sequence length 313
Comment N-acetyl-gamma-glutamyl-phosphate reductase [Pseudomonas monteilii SB3078]
Sequence
MHTPVVFIDGDQGTTGLQIHARLQGRSDLRLLTLPEAERKDPQRRREAINSADIALLCLP
DDAAREAVAAIHNPQVRVIDASSAHRTSPGWVYGLPELDEQQAERIAHSKRVSNPGCYPT
GAIALLRPLVKAGLLPADYPLNIHAISGYSGGGRAAVERHEQPAAGKTPALQLYGLELAH
KHVPEIQQHAGLSARPMFMPGYGAYRQGIVLSIPLQLRLLPGQVSAEQLQACLQQHYQGA
RHVQLMPLHQHGAAPNLDPEALNDSNDLRLALYANPEHGQVLLTAVFDNLGKGASGAAVQ
NLDLMLGALQVQG
Download sequence
Identical sequences A0A2A3LXI9 F8G1U4 V9V1L3 V9WVS6
gi|339488025|ref|YP_004702553.1| gi|568188050|ref|YP_008960671.1| WP_013973018.1.1643 WP_013973018.1.23948 WP_013973018.1.28354 WP_013973018.1.41505 WP_013973018.1.56258 WP_013973018.1.61620 WP_013973018.1.7288 WP_013973018.1.76210 WP_013973018.1.92076 WP_013973018.1.9402 WP_013973018.1.95946 gi|568182672|ref|YP_008955303.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]