SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568182698|ref|YP_008955329.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568182698|ref|YP_008955329.1|
Domain Number 1 Region: 10-422
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 4.52e-94
Family FMN-linked oxidoreductases 0.0000271
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|568182698|ref|YP_008955329.1|
Sequence length 441
Comment glutamate synthase [Pseudomonas monteilii SB3078]
Sequence
MSEQFPPVLRESATFDRLTIQEIQRAAETGIYDIRGGGTKRRVPHFDDLLLLGASVSRYP
LEGYREKCGTDVLLGTRFAKKPIHLKIPVTIAGMSFGALSANAKEALGRGATIAGTSTTT
GDGGMTPEERGQSQHLVYQYLPSRYGMNPDDLRKADAIEIVLGQGAKPGGGGMLLGMKVT
ERVAGMRTLPIGVDQRSACRHPDWTGPDDLAIKIAEIREITDWEKPIYVKIGASRPYYDV
KLAVKAGADVIVLDGMQGGTAATQEVFIEHVGIPILPAIPQAVQALQEMGMHRKVQLIVS
GGIRNGADVAKAMALGADAVAIGTAALIALGDNHPRLDAELKKIGSAAGFYDDWQNGRDP
AGITTQDPELARRLNPEEAGRRLANYLRVLVLEAQTMARACGKSHLHNLDPEDLVALTVE
AAAMARVPLAGTAWVPGQAQY
Download sequence
Identical sequences A0A059UTI6 A0A099N0N0 A0A0C1HWK7 A0A1L5PPL9 F8G2Z4 L0FN07 V9V2N9 V9WWZ6
2036013507 gi|431803065|ref|YP_007229968.1| gi|568188076|ref|YP_008960697.1| gi|568182698|ref|YP_008955329.1| gi|339488051|ref|YP_004702579.1| WP_013973039.1.1643 WP_013973039.1.23948 WP_013973039.1.28354 WP_013973039.1.35335 WP_013973039.1.41505 WP_013973039.1.52768 WP_013973039.1.56258 WP_013973039.1.57632 WP_013973039.1.59340 WP_013973039.1.61620 WP_013973039.1.71677 WP_013973039.1.7288 WP_013973039.1.7435 WP_013973039.1.76210 WP_013973039.1.76710 WP_013973039.1.80759 WP_013973039.1.92076 WP_013973039.1.9402 WP_013973039.1.95946 WP_013973039.1.99927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]