SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568182715|ref|YP_008955347.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568182715|ref|YP_008955347.1|
Domain Number 1 Region: 208-304
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.00000000000667
Family Multidrug resistance efflux transporter EmrE 0.0096
Further Details:      
 
Domain Number 2 Region: 54-153
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.000000000235
Family Multidrug resistance efflux transporter EmrE 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|568182715|ref|YP_008955347.1|
Sequence length 319
Comment transporter [Pseudomonas monteilii SB3078]
Sequence
MNALRSLIQRQLQSGALYAVLAALGFSFKAIFVKLAYAAGAVDAISLLALRMGLSLPMFA
WLVWASRGQGSAPLNLGDGLRVALLGLLGYYLASLFDFYGLQYISAGLERLILFTYPTLV
LVFQAIALRERPSLRTLSAMGLCYLGLGIAFVHDVSVAGAGQQVVLGSLWVFASAVTYAL
YYSGTGMMLKRMGSMRLAGLCGTASSLMVLAHYLVVAPIGQLWQLPGAVWANAGLMAVFS
TVLPIYWVALAIQRLGPTHTAAVGNLGPVLTVMASWAILSEEISLYQVVGLAVVLFAVSR
LKPRGKQETKVAEARGAAA
Download sequence
Identical sequences A0A059UTJ5 F8G310 V9V423
gi|568182715|ref|YP_008955347.1| gi|568188093|ref|YP_008960715.1| WP_013973054.1.23948 WP_013973054.1.28354 WP_013973054.1.35335 WP_013973054.1.56258 WP_013973054.1.7288 gi|339488067|ref|YP_004702595.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]