SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568182720|ref|YP_008955352.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568182720|ref|YP_008955352.1|
Domain Number 1 Region: 58-151
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.00000000000981
Family Multidrug resistance efflux transporter EmrE 0.011
Further Details:      
 
Domain Number 2 Region: 194-289
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.000000000034
Family Multidrug resistance efflux transporter EmrE 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|568182720|ref|YP_008955352.1|
Sequence length 292
Comment membrane protein [Pseudomonas monteilii SB3078]
Sequence
MSSSTPLSGVNQPLRGIALVVVATFLFASHDALSKFLGGLYPIIMVVWARYVVHTLLMAG
IFLPKAGLNVLRTRRPLLQTLRALSLLSTSLLFTTGLQYLPLAEATAVNFLAPVLVTALS
APLLKERVTVGQWVAVVMGFIGVLVVVHPGGAMFTPAILYPFGSALGFCFYQLLTRILAA
HDSPTTSNFYAGLCNTLAMSALVPFFWEMPRWDHALLMLALGGFGMTAHLLLTQAFRHAA
PALLAPFSYCQIVFAGLLGLVVYSQVPDTLSLVGISVICLSGLGAAWMQRGK
Download sequence
Identical sequences A0A0C1HWM6 A0A0P7DBR9 A0A136QGU3 A0A1L5PPQ9 A0A2A3M2E9 L0FJD2 V9V430 V9WWQ4
gi|431803084|ref|YP_007229987.1| WP_015270753.1.15314 WP_015270753.1.1643 WP_015270753.1.23948 WP_015270753.1.28354 WP_015270753.1.32670 WP_015270753.1.33515 WP_015270753.1.35335 WP_015270753.1.52768 WP_015270753.1.56258 WP_015270753.1.57632 WP_015270753.1.59340 WP_015270753.1.61620 WP_015270753.1.65739 WP_015270753.1.71677 WP_015270753.1.7435 WP_015270753.1.76210 WP_015270753.1.76710 WP_015270753.1.78427 WP_015270753.1.80759 WP_015270753.1.92076 WP_015270753.1.9402 WP_015270753.1.99927 2036013528 gi|568188098|ref|YP_008960720.1| gi|568182720|ref|YP_008955352.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]