SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568182755|ref|YP_008955392.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568182755|ref|YP_008955392.1|
Domain Number 1 Region: 204-474
Classification Level Classification E-value
Superfamily FAD-linked oxidases, C-terminal domain 1.03e-79
Family Vanillyl-alcohol oxidase-like 0.032
Further Details:      
 
Domain Number 2 Region: 20-231
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 1.07e-67
Family FAD-linked oxidases, N-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|568182755|ref|YP_008955392.1|
Sequence length 499
Comment FAD-binding protein [Pseudomonas monteilii SB3078]
Sequence
MNILYDERVDGALPDVDRAALLQALCAALPDLEILHREEDLKPYECDGLSAYRTVPLLVV
LPERLEQVQALLRLCHQRGVPVVARGAGTGLSGGALPLAKGILLVMARFNRILEVNPHGR
FARVQPGVRNLAISQAAAPHGLYYAPDPSSQIACSIGGNVAENAGGVHCLKYGLTVHNLL
KVEILTVEGERLTLGSDALDSPGFDLLALFTGSEGMLGIVTEVTVKLLPKPQVARVLLAS
FDSVEDAGRAVAEIIAAGIIPGGLEMMDNLAIRAAEDFIHAGYPVDAAAILLCELDGVEA
DVHDDCERVAAVLAQAGARDVRLACDEAERVRFWAGRKNAFPAVGRISPDYYCMDGTIPH
RELPRVLKGISDLSAEYGLRVANVFHAGDGNMHPLILFDANLPGELERAEAIGGKILELC
VAVGGSITGEHGVGREKINQMCAQFNSDEITLFHAVKAAFDPQGLLNPGKNIPTLHRCAE
FGAMHVHHGQLPFPDLERF
Download sequence
Identical sequences V9V466
gi|568182755|ref|YP_008955392.1| gi|568188133|ref|YP_008960760.1| WP_024087333.1.23948 WP_024087333.1.28354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]