SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568182788|ref|YP_008955425.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568182788|ref|YP_008955425.1|
Domain Number 1 Region: 1-280
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 3.76e-60
Family beta-Lactamase/D-ala carboxypeptidase 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|568182788|ref|YP_008955425.1|
Sequence length 308
Comment D-alanyl-D-alanine endopeptidase [Pseudomonas monteilii SB3078]
Sequence
MKTSLSILSLLLLLTGTATLPSTAAAQPPAQVQRDPSKLHLASGSALLIDLNTNQELYSS
HADRVVPIASVTKLMTAMVVLDAKQPMDEMLTMTIANNPEMKGVYSRVRLGSQLDRRETL
LITLMSSENRAANTLANHYPGGYPAFIKAMNAKARSLGMAHTRYVEPTGLSTQNVSTARD
LAKLLMASRKYPMLSELSTTREKTVAFRKPNYTLGFRNTDHLVNKSNWDIKLTKTGFTNE
AGHCLVLLTRMDNRPVAMVILDAFGKYTHFADASRMRQWLETGAAKPAPAVAMQYKAERQ
NKGRLAAE
Download sequence
Identical sequences A0A0C1I1J7 A0A0M2ULX9 A0A0P7D1L2 A0A136QGJ9 A0A2A3M328 V7D6D6 V9V308
gi|568182788|ref|YP_008955425.1| gi|568188166|ref|YP_008960793.1| WP_023662495.1.23948 WP_023662495.1.28354 WP_023662495.1.35335 WP_023662495.1.36363 WP_023662495.1.56258 WP_023662495.1.57632 WP_023662495.1.65739 WP_023662495.1.71677 WP_023662495.1.7288 WP_023662495.1.7435 WP_023662495.1.80759 WP_023662495.1.95946 WP_023662495.1.98117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]