SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568182855|ref|YP_008955494.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568182855|ref|YP_008955494.1|
Domain Number 1 Region: 85-322
Classification Level Classification E-value
Superfamily DNA breaking-rejoining enzymes 7.36e-71
Family Eukaryotic DNA topoisomerase I, catalytic core 0.00031
Further Details:      
 
Domain Number 2 Region: 29-90
Classification Level Classification E-value
Superfamily DNA topoisomerase I domain 1.07e-22
Family Vaccinia DNA topoisomerase I, 9 kDa N-terminal fragment 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|568182855|ref|YP_008955494.1|
Sequence length 340
Comment DNA topoisomerase [Pseudomonas monteilii SB3078]
Sequence
MLDCPLPRTLHYVDDSQPGLTRRRWRGRFIYLDADGQRVRDSDTLARIAALAIPPAYTEV
WICADPQGHLQATGRDARGRKQYRYHAQWREIRDQHKYGRMLAFAQALPKLRAQLHDHLA
RPGLDREKVMALVISLLDHTLIRIGNQRYLRDNQSYGLTTLRNRHVEVKGSSIRFQFRGK
RGVEHNVSLNDRRLANLLKRCMELPGQALFQYLDDDGQRHSVGSSEVNQFLQQLTGADFT
AKDYRTWAGSSLALDLLRPLAWEPESEAKRQVAAIVRQVASRLGNTPAVCRRCYIHPAVL
EHYALGRLANLPKNRVRKGLDREEVALLLFLQALEEQDDH
Download sequence
Identical sequences A0A059V3L0 A0A099N173 F8G501 V9V4I1
gi|568182855|ref|YP_008955494.1| WP_013973191.1.23948 WP_013973191.1.28354 WP_013973191.1.35335 WP_013973191.1.56258 WP_013973191.1.65739 WP_013973191.1.7288 WP_013973191.1.80759 WP_013973191.1.95946 gi|339488212|ref|YP_004702740.1| gi|568188233|ref|YP_008960862.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]