SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568182898|ref|YP_008955542.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568182898|ref|YP_008955542.1|
Domain Number 1 Region: 172-311
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 6.26e-34
Family Glutathione S-transferase (GST), C-terminal domain 0.024
Further Details:      
 
Domain Number 2 Region: 35-147
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000000134
Family Glutathione S-transferase (GST), N-terminal domain 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|568182898|ref|YP_008955542.1|
Sequence length 319
Comment glutathione S-transferase [Pseudomonas monteilii SB3078]
Sequence
MGLLIDGRWHDQWYENGKDGTFKRENAQRRNQLPAPEAGRYHLYVSLACPWAHRTLIFRA
LKGLEPLIDVSVVSWLMQDHGWTFDQQQGSSGDHLDALQYLHQRYTQDDPHYTGRVTVPV
LWDKKEKRIVNNESSEIIRIFNSAFNELTGNTLDLYPEPLRPTIEALNERIYPAVNNGVY
RAGFATTQEAYEAAFDEVFNELDYLEDLLSRNRYLAGEYLTEADVRLFTTLVRFDAVYHG
HFKCNLRRLSDYHNLSNWLRELYQWPGVAGTVDMEHIQKHYYMSHKTINPNGIVPKGPLQ
DFNLPHDRERLAGKGIWQA
Download sequence
Identical sequences A0A059V3J8 A0A099N3U7 A0A0C1HTL1 F8G5Q6 V7DAI1 V9V3A9
gi|568182898|ref|YP_008955542.1| WP_013973281.1.23948 WP_013973281.1.28354 WP_013973281.1.35335 WP_013973281.1.41505 WP_013973281.1.56258 WP_013973281.1.57632 WP_013973281.1.65739 WP_013973281.1.7288 WP_013973281.1.7435 WP_013973281.1.80759 gi|339488307|ref|YP_004702835.1| gi|568188276|ref|YP_008960910.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]