SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568182900|ref|YP_008955544.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568182900|ref|YP_008955544.1|
Domain Number 1 Region: 116-422
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.51e-99
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000434
Further Details:      
 
Domain Number 2 Region: 1-112
Classification Level Classification E-value
Superfamily tRNA-binding arm 1.62e-29
Family Seryl-tRNA synthetase (SerRS) 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|568182900|ref|YP_008955544.1|
Sequence length 426
Comment seryl-tRNA synthetase [Pseudomonas monteilii SB3078]
Sequence
MLDSKLLRGQLQEVADRLASRGFSLDVARIESLEERRKAVQTRTEQLQAERNARSKSIGQ
AKAKGEDIAPLMADVERMANELAAGKTELDGIQAELDGILLTIPNLPDASVPVGASEDDN
VEVRRWGTPKAFDFEIKDHVALGEVSGGLDFEAAAKLSGARFAVLRGPVARLHRALAQFM
INLHTGEHGYEEHYTPYLVQAPALQGTGQLPKFEEDLFKISREGEADFYLIPTAEVSLTN
LVAGEILDAKQLPLKLVAHTPCFRSEAGASGRDTRGMIRQHQFDKVEMVQVVEPSKSMEA
LEGLTANAERVLQLLELPYRVLALCTGDMGFGAVKTYDLEVWVPSQDKYREISSCSNCGD
FQARRMQARWRNPETGKPELVHTLNGSGLAVGRTLVAVLENYQQADGSIRVPEVLKPYMG
GVEVIR
Download sequence
Identical sequences A0A059UUM7 A0A099N2Z2 A0A0C1KCF8 A0A0M2UHN8 F8G5Q8 J8VBR2 L0FNP5 V7D6W2 V9V4M6
2035925419 WP_003258877.1.1643 WP_003258877.1.23948 WP_003258877.1.28354 WP_003258877.1.35335 WP_003258877.1.36363 WP_003258877.1.56258 WP_003258877.1.57632 WP_003258877.1.65739 WP_003258877.1.71677 WP_003258877.1.7288 WP_003258877.1.7435 WP_003258877.1.80759 WP_003258877.1.95946 WP_003258877.1.98117 gi|568182900|ref|YP_008955544.1| gi|431803325|ref|YP_007230228.1| gi|568188278|ref|YP_008960912.1| gi|339488309|ref|YP_004702837.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]