SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568182933|ref|YP_008955577.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568182933|ref|YP_008955577.1|
Domain Number 1 Region: 1-320
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 2.66e-76
Family FMN-linked oxidoreductases 0.00000108
Further Details:      
 
Domain Number 2 Region: 338-418
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.00000000000151
Family Ferredoxin domains from multidomain proteins 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|568182933|ref|YP_008955577.1|
Sequence length 424
Comment dihydropyrimidine dehydrogenase subunit B [Pseudomonas monteilii SB3078]
Sequence
MADLSIEFAGIKAPNPFWLASAPPTDKAYNVVRAFEAGWGGVVWKTLGEDPAAVNVSSRY
SAHYGPNRQVQGINNIELITDRSLDINLREITQVKKDWPDRALIVSLMVPCVEDSWKFIL
PLVEATGADGIELNFGCPHGMPERGMGAAVGQVPEYVEMVTRWCKTYCSLPVIVKLTPNI
TDIRQSARAAHRGGADAVSLINTINSITSVDLDRMVAHPIVGDQSTHGGYCGSAVKPIAL
NMVAEIARDPQTRGLPICGIGGIGSWRDAAEFMALGSGAVQVCTAAMLHGFRIVEDMKDG
LARWMDQHGHRNIEAFRGQAVGHTTDWKYLDMNYKSVAHIDQQACIGCGRCHIACEDTSH
QAIASTLNADGTHAYSVIEEECVGCNLCQITCPVENCIEMVAQDTGKPYLNWTQDPRNPY
REAS
Download sequence
Identical sequences A0A099N3W7 F8G5U1 V7D5W7 V9V3D8
WP_013973314.1.23948 WP_013973314.1.28354 WP_013973314.1.56258 WP_013973314.1.7288 WP_013973314.1.80759 gi|568182933|ref|YP_008955577.1| gi|339488342|ref|YP_004702870.1| gi|568188311|ref|YP_008960945.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]