SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568182934|ref|YP_008955578.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568182934|ref|YP_008955578.1|
Domain Number 1 Region: 81-204
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 1e-35
Family Tetracyclin repressor-like, C-terminal domain 0.00011
Further Details:      
 
Domain Number 2 Region: 7-73
Classification Level Classification E-value
Superfamily Homeodomain-like 3.44e-19
Family Tetracyclin repressor-like, N-terminal domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|568182934|ref|YP_008955578.1|
Sequence length 206
Comment TetR family transcriptional regulator [Pseudomonas monteilii SB3078]
Sequence
MANHKIEIRRRNIEKILQAAEKVFAEKGYGATSMGDIAEQAELPRSNLHYYFSTKDDLFR
AVLQDLLDVWKQDALCFENFDDPRVVLTSYIRAKMGHSRSRPLGSKIWAEEMLHGAPVLG
VNLDESLVPWAKLKEAKIRRWVEEGRILPVEPSALLYMIWASTQHYADFGYQVTLLNGGE
ALSDMAFENAVQTVTSVILRGIGLEP
Download sequence
Identical sequences A0A0C1KVM2 A0A0M2UFL7 A0A0P7D2U3 A0A136Q9J5 A0A1L5PSP5 A0A2A3M3A8 L0FLZ9 V9V004
WP_015270992.1.1643 WP_015270992.1.23948 WP_015270992.1.28354 WP_015270992.1.32670 WP_015270992.1.35335 WP_015270992.1.36363 WP_015270992.1.41505 WP_015270992.1.52768 WP_015270992.1.56258 WP_015270992.1.57632 WP_015270992.1.59340 WP_015270992.1.61620 WP_015270992.1.65739 WP_015270992.1.71677 WP_015270992.1.7288 WP_015270992.1.7435 WP_015270992.1.76710 WP_015270992.1.80759 WP_015270992.1.92076 WP_015270992.1.9402 WP_015270992.1.95946 WP_015270992.1.98117 WP_015270992.1.99927 gi|568188312|ref|YP_008960946.1| gi|431803362|ref|YP_007230265.1| gi|568182934|ref|YP_008955578.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]