SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568182937|ref|YP_008955581.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568182937|ref|YP_008955581.1|
Domain Number 1 Region: 189-498
Classification Level Classification E-value
Superfamily Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain 8.5e-107
Family Glucose 6-phosphate dehydrogenase-like 0.00000371
Further Details:      
 
Domain Number 2 Region: 7-202
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 4.18e-55
Family Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|568182937|ref|YP_008955581.1|
Sequence length 501
Comment glucose-6-phosphate 1-dehydrogenase [Pseudomonas monteilii SB3078]
Sequence
MTKQSIPAAPPCTLFLFGANGDLVKRLLMPALYNLSRDGLLDRNLRIVGVDHNPATAEEF
AERLHAFMVERDKGGEGTAKCLDEKLWARLAKRLDYQTGDFLDPATYQALAKRIDTTRHG
NAIFYLATSPRFFPEVAQRLGQAGLLDESAGGFRRVVVEKPFGTDLASAEALNACLLKVM
GERQIYRIDHYLGKETVQNILVSRFSNGLFESFWNNHYIDHVQITAAETVGVETRGAFYD
STGALRDMVPNHLFQLLAMVAMEPPAAFAADAVRSEKAKVVGAIRPWSVKMALKNSVRGQ
YSAGKQGRKQLPGYRHEPNVAADSQTETYVALKVMIDNWRWAGVPFYLRTGKRMSVRDTE
IAICFKPAPYAQFRESELERPKPNYLKIQIQPNEGMWFDLQAKRPGPELVMENVELGFAY
KDFFKMTPATGYETLIYDCLTGDQTLFQRADNIENGWRAVQPFLDAWAQGGEVHEYPAGE
DGPEAGNELLARDKREWHWLG
Download sequence
Identical sequences F8G5U5 V9V2F5
gi|339488346|ref|YP_004702874.1| WP_013973318.1.23948 WP_013973318.1.28354 WP_013973318.1.56258 WP_013973318.1.7288 gi|568182937|ref|YP_008955581.1| gi|568188315|ref|YP_008960949.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]