SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568182989|ref|YP_008955641.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568182989|ref|YP_008955641.1|
Domain Number 1 Region: 107-228
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 5.32e-29
Family Glutathione S-transferase (GST), C-terminal domain 0.0046
Further Details:      
 
Domain Number 2 Region: 12-102
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.26e-20
Family Glutathione S-transferase (GST), N-terminal domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|568182989|ref|YP_008955641.1|
Sequence length 231
Comment glutathione S-transferase [Pseudomonas monteilii SB3078]
Sequence
MTDLSAFPITRKWPARHPERLQLYSLPTPNGVKVSIMLEEIGLAYEPHKVSFDNDDQLSP
EFISLSANNKIPAILDPNGPGGQPLPLFESGAILQYLAEKSGQLLSQDPAQRYQTLQWLM
FQMGGIGPMFGQVGFFHFFAGKEYEDKRPRDRYVNESKRLLGVLERHLKGREWMVDEYSI
ADIAIFPWVRNLVERYNARDLVGFDQFKEVQRVLAAFLERPAVQRGLKIPG
Download sequence
Identical sequences V9V045
gi|568188367|ref|YP_008961009.1| gi|568182989|ref|YP_008955641.1| WP_024087405.1.23948 WP_024087405.1.28354 WP_024087405.1.56258 WP_024087405.1.7288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]