SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568183160|ref|YP_008955819.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568183160|ref|YP_008955819.1|
Domain Number 1 Region: 1-210,955-1156
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.47e-60
Family ABC transporter ATPase domain-like 0.0000191
Further Details:      
 
Domain Number 2 Region: 480-659
Classification Level Classification E-value
Superfamily Smc hinge domain 0.0000114
Family Smc hinge domain 0.011
Further Details:      
 
Weak hits

Sequence:  gi|568183160|ref|YP_008955819.1|
Domain Number - Region: 226-432
Classification Level Classification E-value
Superfamily Tropomyosin 0.000283
Family Tropomyosin 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|568183160|ref|YP_008955819.1|
Sequence length 1162
Comment chromosome segregation protein SMC [Pseudomonas monteilii SB3078]
Sequence
MRLKCIRLAGFKSFVDPTTVNFPSNMAAVVGPNGCGKSNIIDAVRWVMGESSAKNLRGES
MTDVIFNGSSGRKPVSQASIELVFDNSETTLVGEYAAYAEISIRRKVTRDGQNSYYLNGT
KCRRRDITDIFLGTGLGPRSYSIIEQGMISKLIEAKPEELRNFIEEAAGISKYKERRRET
ESRIRRTQENLARLTDLREELERQLERLHRQAQAAEKYREYKAQERQLKARLSALRWRDL
DERVRQREAVIGDQDVSHEALVAEQRNADASIERLRDGHHELSERFNQVQGRFYSVAGDI
ARVEQSIQHGQQRLRQLQDDFKEAERTRLETESHLGHDRTLLATLGEELAMLEPEQEMTL
AAAEEAAAALEEAELGMHGWQEQWDSFNSRSAEPRRQAEVQQARLQQLEASLERQAERQR
KLGEERELLGSDPQDAAMLELAEQLASSEMLLEELQLSEEQVVERLEGAREQLQQATQAQ
QQAQGDLQRLGGRLASLEALQQAALEPGAGAADWLQGQGLEQRPRLAEGLRVEPGWELAV
ETVLGADLQAVLVDDFSNLDFAGLEQGELRLLLASGTGSSLPGSLLEKVEGRVDLSPWLG
QVKPVGDLAQALAQRASLGEGQSLVSRDGYWVGRHFLRVRRGGEAEGGLLARGQEIERLG
QEQLEQEAALEQLEQQLQALREQQLDLEEQREQLRRRTQEESRLHGELKANLSAGRARAE
QVELRRRRLQEELAELEEQRALEHEQLGEARLLLQEALELMAQDTEQREQLMARRDTLRE
SLDRVRQEARQHKDHAHQLAVRLGSLRAQHDSTRQALERLEQQAARLTERQEQLSLNLEE
GEAPQEELRLKLEELLERRMSVDEEMRQARLHMDEADRELRDAEKRRTQAEQQAQLLRGQ
LEQLRLECQGLDVRRKTLQEQLLADGYDLQGVLATLEAEASEQGTEQELEQLEARIQRLG
AINLAAIEEYEQQSERKRYLDAQDADLVEALETLENVIRKIDKETRNRFKDTFDQINAGL
QALFPKVFGGGSAYLELTGEDLLDTGVTIMARPPGKKNSTIHLLSGGEKALTALALVFAI
FKLNPAPFCMLDEVDAPLDDANVGRYARLVKEMSESVQFIYITHNKIAMEMADQLMGVTM
HEPGCSRLVAVDVEEAMAMVDA
Download sequence
Identical sequences F8FTV8 V9V405
gi|339488573|ref|YP_004703101.1| WP_013973521.1.23948 WP_013973521.1.28354 WP_013973521.1.56258 WP_013973521.1.7288 gi|568183160|ref|YP_008955819.1| gi|568188536|ref|YP_008961185.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]