SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568183162|ref|YP_008955821.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568183162|ref|YP_008955821.1|
Domain Number 1 Region: 184-361
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 1.21e-53
Family CO dehydrogenase flavoprotein N-terminal domain-like 0.0000261
Further Details:      
 
Domain Number 2 Region: 367-472
Classification Level Classification E-value
Superfamily CO dehydrogenase flavoprotein C-terminal domain-like 3.27e-36
Family CO dehydrogenase flavoprotein C-terminal domain-like 0.0000671
Further Details:      
 
Domain Number 3 Region: 97-202
Classification Level Classification E-value
Superfamily CO dehydrogenase ISP C-domain like 5.36e-34
Family CO dehydrogenase ISP C-domain like 0.00015
Further Details:      
 
Domain Number 4 Region: 2-90
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 9.57e-18
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|568183162|ref|YP_008955821.1|
Sequence length 484
Comment molybdopterin dehydrogenase [Pseudomonas monteilii SB3078]
Sequence
MIQFLVNQELRSEHALDPNMTVLQYLREHLGKPGTKEGCASGDCGACTVVVGELTQDDQG
NDSIRYRSLNSCLTFVSSLHGKQLISVEGLKHQGQLHSVQQAMADCHGSQCGFCTPGFVM
SLFALQKNSSGPDLHQAQEALAGNLCRCTGYRPILDAAEQSCRQPCRDQFDAQQAQTISR
LKAIAPTQTGELNSGDKRCLVPLTVADLADLYSSHPEARLLAGGTDLALEVTQFHKTLPV
MIYVGHVAELKRIEKTASHLEIGAATPLTDCYGALNEEYPDFGALLHRFASLQIRNQGTL
GGNIGNASPIGDSPPLLIALDAQIVLRQGDRQRVMPLEDYFIDYRITARQDSEFIEKIIV
PRATSDWAFRAYKVSKRLDDDISAVCGAFNLSIEDGVVSGVRIAFGGMAAVPKRARACEA
ALRGKPWNQAAIERACQALAEDFTPLSDFRASKEYRLLTAQNLLRKYFIEQQTPYIETRV
TAYV
Download sequence
Identical sequences A0A059V435 A0A099N1U1 F8FTW0 V7DEF0 V9V5D9
gi|568183162|ref|YP_008955821.1| WP_013973523.1.23948 WP_013973523.1.28354 WP_013973523.1.35335 WP_013973523.1.56258 WP_013973523.1.65739 WP_013973523.1.7288 WP_013973523.1.80759 gi|568188538|ref|YP_008961187.1| gi|339488575|ref|YP_004703103.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]