SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568183189|ref|YP_008955849.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568183189|ref|YP_008955849.1|
Domain Number 1 Region: 188-288
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.000000000000379
Family Multidrug resistance efflux transporter EmrE 0.0093
Further Details:      
 
Domain Number 2 Region: 39-141
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.000000000222
Family Multidrug resistance efflux transporter EmrE 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|568183189|ref|YP_008955849.1|
Sequence length 298
Comment multidrug DMT transporter permease [Pseudomonas monteilii SB3078]
Sequence
MDSSLRRGSLEMVAAMLISGTIGWFVLVSGQPVLEVVFWRCVFGAVTLLAICAGFGFLRP
GVISRTAFLLAIASGVAIVGNWVLLFASYSRASIAIGTAVYNVQPFMLVGLAAVFLGEKI
TLAKVTWLSVAFLGMLAIVSAHGAGQGGGEDYLLGIALALGAAFLYAIAALIIKRLSGTP
PHLIALIQVATGVLLLAPWVKLGGLPGEVPALASLVTLGMVHTGLMYVLLYSAIQRLPTA
LTGALSFIYPIAAILVDWVAFGHRLAPLQWLGVALILLAAAGMQQGWWFRPARVVAEE
Download sequence
Identical sequences A0A059V4G3 A0A1L5PU32 V9V340
WP_024087447.1.23948 WP_024087447.1.28354 WP_024087447.1.35335 WP_024087447.1.41505 WP_024087447.1.52768 WP_024087447.1.56258 WP_024087447.1.59340 WP_024087447.1.65739 WP_024087447.1.7288 WP_024087447.1.76710 gi|568183189|ref|YP_008955849.1| gi|568188565|ref|YP_008961215.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]