SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568183317|ref|YP_008955982.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568183317|ref|YP_008955982.1|
Domain Number 1 Region: 259-536
Classification Level Classification E-value
Superfamily FAD-linked oxidases, C-terminal domain 6.21e-49
Family D-lactate dehydrogenase 0.094
Further Details:      
 
Domain Number 2 Region: 6-193,245-280
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 6.54e-49
Family FAD-linked oxidases, N-terminal domain 0.0089
Further Details:      
 
Domain Number 3 Region: 556-617,646-683
Classification Level Classification E-value
Superfamily alpha-helical ferredoxin 0.00000159
Family Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|568183317|ref|YP_008955982.1|
Sequence length 1006
Comment FAD-linked oxidase [Pseudomonas monteilii SB3078]
Sequence
MIAQLPTVAPSANYPEFLEALRNSGFRGQISADYGTRTVLATDNSIYQRLPQAAVFPLDA
DDVARVATLMAEGRFQQVKLTPRGGGTGTNGQSLTDGIVVDLSRHMNKILEINVEERWVR
VQAGTVKDQLNAALKPHGLFFAPELSTSNRATVGGMINTDASGQGSCTYGKTRDHVLELH
SVLLGGERLHSLPIDDAALEQACAAPGRVGEVYRMAREIQETQADLIEATFPKLNRCLTG
YDLAHLRDEQGRFNLNSVLCGAEGSLGYVVEAKLNVLPIPKYAVLVNVRYTSFMDALRDA
NALMAHKPLSIETVDSKVLMLAMKDIVWHSVAEYFPADPERPTLGINLVEFCGDEPAEVN
AKVQAFIQHLQNDTSVERLGHTLAEGAEAVTRVYTMRKRSVGLLGNVEGEVRPQPFVEDT
AVPPEQLADYIADFRALLDGYGLAYGMFGHVDAGVLHVRPALDMKDPAQAALVKPISDAV
AALTKSYGGLLWGEHGKGLRSEYVPEYFGELYPALQRLKGAFDPHNQLNPGKICTPLGSA
EGLTPVDGVTLRGDLDRTIDERVWQDFPSAVHCNGNGACYNYDPNDAMCPSWKATRERQH
SPKGRASLMREWLRLQGEADIDVLAAARNKVSWLKGLPARLRNNRARSQGQEDFSHEVYD
AMAGCLACKSCAGQCPIKVNVPDFRSRFLELYHGRYQRPLRDYLIGSLEFTIPYLAHAPG
LYNAVMGSKWVSKLLADKVGMVDSPLISRFNFQATLTRCRVGVASVPALRELTPAQRERS
IVLVQDAFTRYFETPLLSAFIDLAHRLGHRVFLAPYSANGKPLHVQGFLGAFAKAAIRNA
TQLKALADCGVPLVGLDPAMTLVYRQEYQKVPGLDGCPQVLLPQEWLMDVLPEQAPTAPG
TFRLMAHCTEKTNVPASTKQWEQVFARLGLKLVTEATGCCGMSGTYGHEARNQDTSRTIF
EQSWATKLDKEGEPLATGYSCRSQVKRMTERQMRHPLEVVLQYAQR
Download sequence
Identical sequences A0A059V4P2 V9V3K3
gi|568188690|ref|YP_008961345.1| gi|568183317|ref|YP_008955982.1| WP_024087507.1.23948 WP_024087507.1.28354 WP_024087507.1.35335 WP_024087507.1.65739 WP_024087507.1.7288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]