SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568183378|ref|YP_008956046.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|568183378|ref|YP_008956046.1|
Domain Number - Region: 37-88
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.0889
Family Multidrug resistance efflux transporter EmrE 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|568183378|ref|YP_008956046.1|
Sequence length 103
Comment membrane protein [Pseudomonas monteilii SB3078]
Sequence
MNRTAQFRSFAEFYPYYLGEHSNPTCRRLHFVGTSLVIALLAYTIGSGKWLLLLALPVFG
YGFAWVGHFFFERNRPATFTHPLYSLIGDFVMFRDILLGKISL
Download sequence
Identical sequences A0A059V1H2 A0A099N2G8 A0A0C1KXN1 F8FWN1 V7D824 V9V4N6
WP_013973679.1.1643 WP_013973679.1.23948 WP_013973679.1.28354 WP_013973679.1.35335 WP_013973679.1.56258 WP_013973679.1.65739 WP_013973679.1.7288 WP_013973679.1.7435 WP_013973679.1.80759 gi|568183378|ref|YP_008956046.1| gi|339488748|ref|YP_004703276.1| gi|568188751|ref|YP_008961409.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]