SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568183381|ref|YP_008956049.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568183381|ref|YP_008956049.1|
Domain Number 1 Region: 182-280
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.00000000000000353
Family Multidrug resistance efflux transporter EmrE 0.0082
Further Details:      
 
Domain Number 2 Region: 41-137
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.000000000968
Family Multidrug resistance efflux transporter EmrE 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|568183381|ref|YP_008956049.1|
Sequence length 296
Comment membrane protein [Pseudomonas monteilii SB3078]
Sequence
MNHRTALGALHIGALFFGLTGVFGKLAASASPVIIVFGRAAFAVLALALFASLAGPGWQR
LSGQDARRLLLGGVLLAGHWVSFFIAVKVAGVAIATLGFASFPAFTVILEGLLFRERIRR
NEALLVLLVSIGLVLVTPAFDLASEATGGLLWSLLSGLLFSLLSLTNRAGSGRLPAVQAA
LWQNLVVGLCLLPFAVPDLAGVATMDWLWIALLGIFCTGVAHSLFVASLSVIKARTAAVV
FGMEPVYGIAVAWVVFAETPTLRMLLGGALIIFAIVLSSRLAAEQPPRQRPLAESA
Download sequence
Identical sequences A0A059V4Q3 A0A099N2I1 F8FXS7 V9V307
gi|568188754|ref|YP_008961412.1| gi|339488752|ref|YP_004703280.1| WP_013973683.1.23948 WP_013973683.1.28354 WP_013973683.1.35335 WP_013973683.1.56258 WP_013973683.1.65739 WP_013973683.1.7288 WP_013973683.1.80759 gi|568183381|ref|YP_008956049.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]