SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568183397|ref|YP_008956065.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568183397|ref|YP_008956065.1|
Domain Number 1 Region: 196-296
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.000000000000562
Family Multidrug resistance efflux transporter EmrE 0.013
Further Details:      
 
Domain Number 2 Region: 48-146
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.00000000000811
Family Multidrug resistance efflux transporter EmrE 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|568183397|ref|YP_008956065.1|
Sequence length 308
Comment membrane protein [Pseudomonas monteilii SB3078]
Sequence
MSAARKNPDAFAFQVMLGLCLIWGCQQVLIKTAAIDIAPVMQAALRNGIAAVLVGLMLCW
RGGWEQVGSTWRAGVVAGGLFGLEFLFIAEGLKLTSAAHMSVFLYTAPVFTALGLHFRLP
SERLRLLQWLGILLAFGGIAMAFAGGMSFEHMDGRTLLGDAFGVIAGLAWGATTVVVRCS
RLSEAPATLTLFYQLAVGFAGLLLIALLSGQIGAVTLTPLAMGSVLFQGIVVSFISYLTW
FWLLRKYLASNLAVFSFITPLFGVTFGVLLLDEPLSLNFVVGALMVLLGVVLVSAEPWVK
QQLRKFVG
Download sequence
Identical sequences A0A059V4I1 A0A099N2L5 A0A0C1I2C6 F8FXU3 V7DEX2 V9V3S7
gi|339488768|ref|YP_004703296.1| gi|568188770|ref|YP_008961428.1| WP_013973697.1.1643 WP_013973697.1.23948 WP_013973697.1.28354 WP_013973697.1.35335 WP_013973697.1.56258 WP_013973697.1.65739 WP_013973697.1.7288 WP_013973697.1.7435 WP_013973697.1.80759 gi|568183397|ref|YP_008956065.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]