SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568183435|ref|YP_008956103.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568183435|ref|YP_008956103.1|
Domain Number 1 Region: 46-138
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.0000000000000196
Family Multidrug resistance efflux transporter EmrE 0.011
Further Details:      
 
Domain Number 2 Region: 186-289
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.0000000000000327
Family Multidrug resistance efflux transporter EmrE 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|568183435|ref|YP_008956103.1|
Sequence length 291
Comment DMT transporter permease [Pseudomonas monteilii SB3078]
Sequence
MSPIALARLLTLAAVWGASFLFMRIIAPELGTVPTAFFRVSIACLGLVALLAAARVRWDF
QGKLGACLVLGMINSGIPATFYSVAAQVLPAGYSAIFNATTPLMGVLVGVLFFREPMTLA
KLCGIFLGLFGVGILSGAGPVALDLALLQGALACLAATSCYGFAGFLARRWVSGLDSRLS
ALGSMLGATLMLSPLFAWSALSQPPASWGGWQVWLSLLGLGLLCTAFAYILYFRLLEEIG
PVKASTVTFLIPVFGVLWGAWLLDEPLSMAHLYGGLLIGVALWLVLRPARS
Download sequence
Identical sequences F8FXY0 V9V679
WP_013973731.1.23948 WP_013973731.1.28354 WP_013973731.1.56258 WP_013973731.1.65739 gi|568183435|ref|YP_008956103.1| gi|339488805|ref|YP_004703333.1| gi|568188808|ref|YP_008961466.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]