SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568183554|ref|YP_008956225.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568183554|ref|YP_008956225.1|
Domain Number 1 Region: 52-201
Classification Level Classification E-value
Superfamily OMPA-like 0.00000000000000256
Family Outer membrane protein 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|568183554|ref|YP_008956225.1|
Sequence length 201
Comment membrane protein [Pseudomonas monteilii SB3078]
Sequence
MKTFNTLLAAMAVCAAGITTAQAADDNFASLTYGQTSDKVRKSGLLQRNTDHLNADGIIG
KDDTWGVRVGKINDQGRYYMTYDNVSGDHSGLKLRQENLLGSYDLFLPVGDTTKLFGGGS
LGVTKLTQDSPGASRDTDYGYAYGLQAGVIQDITDKASVELGYRYLRTNAATEVGAHGGP
KDGTLRLTSSAQTYLAASYKF
Download sequence
Identical sequences A0A059UTP0 A0A099N546 A0A0C1I657 A0A1L5PV23 F8G0J3 L0FPP0 V7DC52 V9V1Q8 V9X1P0
WP_013973837.1.15314 WP_013973837.1.23948 WP_013973837.1.28354 WP_013973837.1.32670 WP_013973837.1.33515 WP_013973837.1.35335 WP_013973837.1.35716 WP_013973837.1.36363 WP_013973837.1.41505 WP_013973837.1.56258 WP_013973837.1.57632 WP_013973837.1.59340 WP_013973837.1.65739 WP_013973837.1.71677 WP_013973837.1.7288 WP_013973837.1.7435 WP_013973837.1.76210 WP_013973837.1.78427 WP_013973837.1.80759 WP_013973837.1.95946 WP_013973837.1.99927 gi|568188927|ref|YP_008961588.1| gi|339488923|ref|YP_004703451.1| 2035948554 gi|431804023|ref|YP_007230926.1| gi|568183554|ref|YP_008956225.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]