SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568183607|ref|YP_008956285.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568183607|ref|YP_008956285.1|
Domain Number 1 Region: 104-227
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.00000000000000845
Family Tetracyclin repressor-like, C-terminal domain 0.012
Further Details:      
 
Domain Number 2 Region: 28-98
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000000103
Family Tetracyclin repressor-like, N-terminal domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|568183607|ref|YP_008956285.1|
Sequence length 238
Comment TetR family transcriptional regulator [Pseudomonas monteilii SB3078]
Sequence
MADSKSAQNSAVGPKLGRRRFSELGEVVNKELILNEAEKVFAMHGFLGATLKQIAQNSNV
TQALITYYYGTKQNLFMEVYRRGLSDIDKKRQNYLDELKSRPEGYNTYDIVRTYLRPQFE
HREGGQAWMHFARLQSRLASEPEEVAVPLRKELYDHTLKAFIHEIMECEGEDDAAAVSWG
AVFMVSMILYMLRGVDRIGELTDGHLHAESEDDIVERMTIFITGGINSLKQATQDKYK
Download sequence
Identical sequences A0A0B4KIF6 A0A161YEU4 V9V4B1
WP_024087624.1.23948 WP_024087624.1.28354 WP_024087624.1.33725 WP_024087624.1.56258 WP_024087624.1.65739 WP_024087624.1.87386 gi|568183607|ref|YP_008956285.1| gi|568188980|ref|YP_008961648.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]