SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568183653|ref|YP_008956335.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568183653|ref|YP_008956335.1|
Domain Number 1 Region: 11-376
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 8.97e-79
Family beta-Lactamase/D-ala carboxypeptidase 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|568183653|ref|YP_008956335.1|
Sequence length 381
Comment beta-lactamase [Pseudomonas monteilii SB3078]
Sequence
MQIQGHYELKFEAVREAFAALFEDPQERGAALCIQVGGETVVDLWAGSADKDGQQAWHSD
TIANLFSCTKTFTAVTALQLVGEGKLALDAPVANYWPEFAQAGKQAITLRQLLSHRAGLP
AIRELLPAEALYDWQAMVDALAAETPWWTPGTEHGYAAITYGWLIGELIRRADGRGPGDS
IVARTARPLGLDFHIGLADDEFHRVAHIARGKGNAGDAAAQRLLQVTMREPEALSTRAFT
NPPAILTSTNKPEWRRMQQPAANGHGNARSLAGFYAGLLDGSLLESELLDELTREHSLGQ
DRTLLTQTRFGLGCMLDQPDVANATFGLGARAFGHPGAGGSVGFADPEHDVAFGFVVNTL
GPYVLMDPRAQKLVRVLASCL
Download sequence
Identical sequences A0A059V4W6 A0A099N354 A0A0C1KAR4 V7DDZ8 V9V5F4
gi|568183653|ref|YP_008956335.1| WP_023660953.1.23948 WP_023660953.1.28354 WP_023660953.1.35335 WP_023660953.1.65739 WP_023660953.1.7288 WP_023660953.1.7435 WP_023660953.1.80759 gi|568189026|ref|YP_008961698.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]