SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|568183666|ref|YP_008956353.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568183666|ref|YP_008956353.1|
Domain Number 1 Region: 12-153
Classification Level Classification E-value
Superfamily LEA14-like 1.07e-21
Family LEA14-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|568183666|ref|YP_008956353.1|
Sequence length 161
Comment hypothetical protein X969_20385 [Pseudomonas monteilii SB3078]
Sequence
MIARTRPLLLATLMAWLALLAGCASWGGDDWREPEVHLVEVETVKARLLEQEFVLHLRID
NPNDSRLFIRNLSYAIRLNDLLLVQDETSVWRSVGGHARRTFKITARTNLWQHLKPLAKL
LKSEQPLHYSLQGELATGLLIHRDLHLSRSGEIIPGDYKPE
Download sequence
Identical sequences A0A059V4W9 A0A099N364 A0A136QCZ5 L0FPW7 V7D1C0 V9V3U2
gi|568183666|ref|YP_008956353.1| 2035931656 gi|431804083|ref|YP_007230986.1| WP_015271543.1.23948 WP_015271543.1.28354 WP_015271543.1.35335 WP_015271543.1.57632 WP_015271543.1.65739 WP_015271543.1.71677 WP_015271543.1.7288 WP_015271543.1.80759 WP_015271543.1.95946 gi|568189039|ref|YP_008961716.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]