SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568183718|ref|YP_008956406.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568183718|ref|YP_008956406.1|
Domain Number 1 Region: 23-499
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 1.05e-133
Family FMN-linked oxidoreductases 0.000037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|568183718|ref|YP_008956406.1|
Sequence length 539
Comment glutamate synthase [Pseudomonas monteilii SB3078]
Sequence
MSLSLLSRYAFFAACVLFTLASLPFTHHEWLWPFTLSTGILSLIGLFDLLQQRHAVRRNY
PILGNIRYLVEAIRPEIRQYLLEADSDALPFSRAQRSLVYARAKNEASDKPFGTLIDVYE
SGFEFIGHSMRPAPLADPASFRVIVGGPQCSQPYSASIFNISAMSFGSLSANAIRALNQG
AKLGNFHHDTGEGSISPYHREHGGDLVWELGSGYFGCRTPDGRFDPERFAAQARSPQVRM
IEIKMSQGAKPGHGGILPKHKVTREIAETRGVLMGEDCISPSRHSAFSTPIEMMQFIAQL
RELSGGKPVGFKFCLGHPWEFMGIAKAMLETGILPDFIVVDGKEGGTGAAPVEFTDHIGV
PLREGLLFVHNTLVGLNLRDKIKLGASGKIVSAFDIASVLAIGADWANSARGFMFAIGCI
QSQSCHTNKCPTGVATQDPLRQRALVVPDKAQRVLNFHHNTLRALAEMLAAAGLEHPAQL
EAKHLVRRISATEIKLFSQMHVFLKPGELLTGEVNGQFYSRMWQLARADSFEPNSEVAA
Download sequence
Identical sequences A0A059V253 A0A099N5Y2 A0A136QB91 L0FQT6 V9V5M2
2035931707 gi|568189091|ref|YP_008961769.1| gi|568183718|ref|YP_008956406.1| WP_015271581.1.1643 WP_015271581.1.23948 WP_015271581.1.28354 WP_015271581.1.35335 WP_015271581.1.57632 WP_015271581.1.65739 WP_015271581.1.71677 WP_015271581.1.7288 WP_015271581.1.80759 WP_015271581.1.95946 gi|431804136|ref|YP_007231039.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]