SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568183720|ref|YP_008956408.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568183720|ref|YP_008956408.1|
Domain Number 1 Region: 750-1024
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 4.93e-24
Family beta-Lactamase/D-ala carboxypeptidase 0.028
Further Details:      
 
Domain Number 2 Region: 164-316
Classification Level Classification E-value
Superfamily Lysozyme-like 0.00000000815
Family PBP transglycosylase domain-like 0.012
Further Details:      
 
Domain Number 3 Region: 601-637,672-712,900-977
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 0.0000993
Family beta-Lactamase/D-ala carboxypeptidase 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|568183720|ref|YP_008956408.1|
Sequence length 1049
Comment glycosyl transferase family 51 [Pseudomonas monteilii SB3078]
Sequence
MGALWQSEPSRTEAPEIPPAETPQPKSPRQRRLWWRLIILILLVALVAIGFAAYDEFRTS
NLQSREFSKLASTLTYSLQPGPSDAIVYPGEGPFDKRLGYSALGEFLPRLLKRDYLISEQ
VKFSPALMNYVDHGLFAPYIEKIQAGLSITDCRGDMLYQYNYPQHLYPDFAAIPPVIVNS
LLFIENRDLLDTKDPRNNPAVDWPRFAKAAYSQVAKYLALPGQSAGGSTLATQLEKYRHS
PDGLTVSGAEKIRQMISASVRAYQGGPDTTEARQRIVRDYLNSVPLSAVPGHGEVHGMAE
GLRVWYGADFDQVNQALSSTASDPESMAARGLALRQVLSLMIAQRRPSHYLSKGRLELAE
LTDAHIRVLAANKVIEQPLADAALASKAVYRDWVAQPTIVPIVTNKGISLARNRLAAMLN
RPLYDLDRLDLSATSTLQSDLQLQVSQYLKNLADPEFAAQIGLIGERLLTAKTTDQVSYS
FTLFERTADGSRVRVQTDSTDQPFDINEGSKLELGSTAKLRVLTTYLEIIAELHDKYAGK
PAAELKKVEVAELDRISQWSLEWLAQNSKNQSLDAMLDAALERKYSANTGEAFFTGGGMH
VFNNFRKEDNSRNPTLKDALRESINLPFIRLMRDLVRYVTYQQPYNRVPLLKDDSDPRRQ
EYLARFADKEGTNYLMRFWKKYQRKTSQQRLDTFLDSMRVTPQRLAAVHRYLFPEAGQET
FNAFVRAHLKGDKIVLGKLTDGRLSEMYDAYGPGKYDLPDQGYIAKVHPLDLWLLGYLLK
NPGSTLTEMVNASRFERQEVYGWLFKSRHQGARDSRIRTMVEIEAFLDIHQRWKRVGYPF
DHLVPSLATAIGSSGDRPAALSELVGIIQNDGVRLPTLRIDTLHFAANTPYETKLVTDPD
RGVRILPVEVARALKGAMSQVVDAGTARRISGSFKLQDGTPLVMGGKTGTGDNRIESFGA
GGRLIGSRSLNRTATFVFFLGDNHFGTLTAFVPGRSAEAFKFTSALPVQVLKGMAPILMP
YLQPGNPNECKPPQVAVHTATPQGDTSNE
Download sequence
Identical sequences V9V705
WP_024087671.1.23948 WP_024087671.1.28354 WP_024087671.1.35335 WP_024087671.1.65739 WP_024087671.1.71677 WP_024087671.1.7288 gi|568183720|ref|YP_008956408.1| gi|568189093|ref|YP_008961771.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]