SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568183823|ref|YP_008956512.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568183823|ref|YP_008956512.1|
Domain Number 1 Region: 8-353
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 3.38e-64
Family beta-Lactamase/D-ala carboxypeptidase 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|568183823|ref|YP_008956512.1|
Sequence length 360
Comment beta-lactamase [Pseudomonas monteilii SB3078]
Sequence
MLKGLLLLFCMAMAPAKAEVWPDPDWHNDPASLDWQAVDAYAFPARTTPERSGIRTDALL
IIRDGRILHERYAAPSTAATAHLTWSISKSVLATLLGVAQGEGRFQLQDPVTRFYPAMHA
HPGVRMADLLHWASGLDWQEDYEYAPLKSSVVAMLYTRGREDMAAYTAAREAVASPGQRF
LYSSGDSNLLAAALRGMLDAGQYHDYPWHALFIPLGIDSAVWERDRAGTYVGSSYLYLSA
RDLARIGLLMQRDGRWQDRQLLPKPWVTFNRTPFAEAEALPGEANPGGHWWLNQPLPGAA
RPWPSAPADTYAALGHWGQALYVLPAQKLVIVRYADDRDGSYQHDELLKRILAALAGEGA
Download sequence
Identical sequences A0A059UWZ0 F8G4E5 V9V606
gi|568189196|ref|YP_008961875.1| gi|339489190|ref|YP_004703718.1| WP_013974067.1.23948 WP_013974067.1.28354 WP_013974067.1.35335 WP_013974067.1.56258 WP_013974067.1.65739 WP_013974067.1.7288 gi|568183823|ref|YP_008956512.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]