SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568183864|ref|YP_008956553.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568183864|ref|YP_008956553.1|
Domain Number 1 Region: 12-106
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.83e-16
Family Glutathione S-transferase (GST), N-terminal domain 0.01
Further Details:      
 
Domain Number 2 Region: 81-203
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.0000000000000129
Family Glutathione S-transferase (GST), C-terminal domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|568183864|ref|YP_008956553.1|
Sequence length 210
Comment glutathione S-transferase [Pseudomonas monteilii SB3078]
Sequence
MSYHLIIGDKLYSSWSLRGALALELAGVPYEETLIKLNQPDTRQRILAFSATGKVPLLKT
EHGVIADSLAIAEYLNERHPDAQLWPADVAARAQARSACAQMHSGFFALRGAMPFDLSRD
QALDGVPLEVQIDIDRIVALWSECRLAAKDSGPFLFGRPSLADAFFAPVAVRLRTYRVEV
PAEAAAYIETIYQWPAFQAWQKAGLAEREG
Download sequence
Identical sequences A0A059V2H0 A0A099N3N6 F8G570 V7DA78 V9V2P4
WP_013974104.1.1643 WP_013974104.1.23948 WP_013974104.1.28354 WP_013974104.1.35335 WP_013974104.1.56258 WP_013974104.1.65739 WP_013974104.1.7288 WP_013974104.1.80759 gi|339489231|ref|YP_004703759.1| gi|568183864|ref|YP_008956553.1| 2035969044 gi|568189237|ref|YP_008961916.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]