SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568183891|ref|YP_008956580.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568183891|ref|YP_008956580.1|
Domain Number 1 Region: 78-205
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 6.82e-24
Family Glutathione S-transferase (GST), C-terminal domain 0.011
Further Details:      
 
Domain Number 2 Region: 10-104
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.21e-23
Family Glutathione S-transferase (GST), N-terminal domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|568183891|ref|YP_008956580.1|
Sequence length 207
Comment stringent starvation protein A [Pseudomonas monteilii SB3078]
Sequence
MGVTNRLACYSDPADHYSHRVRLVLAEKGISVQVIDVDPSRLPPKLAEVNPYGSVPTLVD
RDLALYESTVVMEYLEERYPHPPLMPVYPVARGNSRLLMHRIQRDWCSLADTVLDPRSSE
ADRAEARKALRESLTGVSPLFGEFACFMSEEQSLVDCCLLPILWRLPVLGIELPRQAKPL
LEYMERQFAREPFQASLSSVEREMRKL
Download sequence
Identical sequences A0A099N3W6 V7D6Q2 V9V4G2
gi|568189264|ref|YP_008961943.1| WP_023662824.1.23948 WP_023662824.1.28354 WP_023662824.1.35335 WP_023662824.1.56258 WP_023662824.1.65739 WP_023662824.1.7288 WP_023662824.1.80759 gi|568183891|ref|YP_008956580.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]