SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568183897|ref|YP_008956586.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568183897|ref|YP_008956586.1|
Domain Number 1 Region: 1-344
Classification Level Classification E-value
Superfamily NAD(P)-linked oxidoreductase 3.4e-110
Family Aldo-keto reductases (NADP) 0.00000000727
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|568183897|ref|YP_008956586.1|
Sequence length 346
Comment aldo-keto reductase [Pseudomonas monteilii SB3078]
Sequence
MEYRQLGRTDLNVSALCLGTMTWGEQNVQAEAFEQIARAKAAGVNFIDTAEMYPVPPRPE
TYAATERIIGNWFRANGDRDDWVLASKVAGPGNGISHIRDGQLKHNRQHIVAALDESLKR
LQTDRIDLYQLHWPERSTNFFGKLGYQHLPQDHFTPLEETLEVLDEQVRAGKIRHVGLSN
ETPWGTMKFLQLAESRGWPRAVSIQNPYNLLNRSFEVGLAEVAIREQCGLLAYSPLAFGM
LSGKYENGARPENARLTLFSRFARYSNPQTVAACSRYVQLAREHGLDPAQMALAFVTRQP
FVTSNIIGATSLEQLDSNLASLELSLSDELLAAIEAIHQEQPNPAP
Download sequence
Identical sequences A0A099N676 V7D6P7 V9V547 V9WYV3
gi|568183897|ref|YP_008956586.1| gi|568189270|ref|YP_008961949.1| WP_023662822.1.23948 WP_023662822.1.28354 WP_023662822.1.41505 WP_023662822.1.52768 WP_023662822.1.61620 WP_023662822.1.7288 WP_023662822.1.76210 WP_023662822.1.76710 WP_023662822.1.80759 WP_023662822.1.92076 WP_023662822.1.9402 WP_023662822.1.99927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]