SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568183900|ref|YP_008956589.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568183900|ref|YP_008956589.1|
Domain Number 1 Region: 4-333
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 3.94e-78
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.00000396
Further Details:      
 
Domain Number 2 Region: 354-408
Classification Level Classification E-value
Superfamily YegP-like 0.00000000379
Family YegP-like 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|568183900|ref|YP_008956589.1|
Sequence length 449
Comment tryptophanyl-tRNA synthetase [Pseudomonas monteilii SB3078]
Sequence
MTTRILTGITTTGTPHLGNYAGAIRPAIRASQQPGVDSFYFLADYHALIKCDDPLRIQRS
RLEIAATWLAGGLDPDKVTFYRQSDIPEIPELTWLLTCVSAKGLLNRAHAYKASVDKNLE
NGEDPDAGVTMGLYSYPVLMAADILMFNANKVPVGRDQIQHVEMARDIGQRFNHLFGQGK
DFFALPEAVIEESVATLPGLDGRKMSKSYDNTIPLFTSAKEMKDAISRIVTDSRAPGEAK
DPDNAHLFTLFQAFSTPAQCAEFREELLQGLGWGEAKQRLFQLLDGQLAEKREYYHQLIA
RPADLEDILLAGAAKARKIATPFLEQLREAVGLRSFRSSVQASTEVKKKAAKSARFVSFR
DEDGSFRFRLLAADGEQLLLSRSFADGKSAGAVSKQLQQGGKADVRVEGLGFGLWLNGEQ
VAEGPQFDSAEARDSAIESLRAALAPQPD
Download sequence
Identical sequences V9V7K0
gi|568189273|ref|YP_008961952.1| WP_024087710.1.23948 WP_024087710.1.28354 gi|568183900|ref|YP_008956589.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]