SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568183918|ref|YP_008956607.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568183918|ref|YP_008956607.1|
Domain Number 1 Region: 206-443
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.08e-29
Family Type II thymidine kinase 0.071
Further Details:      
 
Domain Number 2 Region: 13-75,111-161
Classification Level Classification E-value
Superfamily PIN domain-like 0.00000000000000157
Family PIN domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|568183918|ref|YP_008956607.1|
Sequence length 464
Comment ATPase [Pseudomonas monteilii SB3078]
Sequence
MDDQGRNPSSSKPILYVLDTNVLIHDPNALLNFEEHHVAIPMTVLEELDKLKTGKQTIAA
ECRQAIRLIDQTLGDASPSDVEQGVPIQRGKSGPKGFLSILMTPRNEPNKLLPENLNDNI
IINQLLEVRARRTDLDVVLVTKDINMRLKARACGIAAEDYSTDQLVDDVSLLSKGYHSVT
GSFWDRVSKVDTRQERGRTWHRVQLIDNLPAVHVNEFIIDEQGFVGWIKGIRNDELLLLD
LHQEPLLHQEAWGLKPRDIHQSLALFALLDPDIHLVNLTGAAGSGKTILALAAAIEQTMV
SKRYRRIIATRSVQGLDQEIGFLPGTEAEKMEPWLGAITDNLEALHMDDESTHGSVEYIL
ERVPLQFKSLNYIRGRSFQQSLILIDECQNLTPHQMKTIITRAGSGSKVVCLGNLAQIDT
PYLSATSSGLTYLTERFKDFPHGVHITLQGVPRSVLAEYAESHL
Download sequence
Identical sequences A0A059V2L3 A0A099N6L4 A0A0C1KVY5 A0A136QIN5 A0A1L5PVY2 F8G5C4 L0FRE0 V7DFZ9 V9V687 V9X4Y2
gi|568183918|ref|YP_008956607.1| gi|339489285|ref|YP_004703813.1| 2035947205 gi|568189291|ref|YP_008961970.1| WP_013974146.1.1643 WP_013974146.1.23948 WP_013974146.1.28354 WP_013974146.1.32670 WP_013974146.1.35335 WP_013974146.1.35716 WP_013974146.1.41505 WP_013974146.1.52768 WP_013974146.1.56258 WP_013974146.1.57632 WP_013974146.1.59340 WP_013974146.1.61620 WP_013974146.1.65739 WP_013974146.1.71677 WP_013974146.1.7288 WP_013974146.1.7435 WP_013974146.1.76210 WP_013974146.1.76710 WP_013974146.1.80759 WP_013974146.1.92076 WP_013974146.1.9402 WP_013974146.1.95946 WP_013974146.1.99927 gi|431804356|ref|YP_007231259.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]