SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568183962|ref|YP_008956652.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568183962|ref|YP_008956652.1|
Domain Number 1 Region: 82-207
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 6.4e-30
Family Glutathione S-transferase (GST), C-terminal domain 0.00026
Further Details:      
 
Domain Number 2 Region: 1-85
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.21e-24
Family Glutathione S-transferase (GST), N-terminal domain 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|568183962|ref|YP_008956652.1|
Sequence length 210
Comment maleylacetoacetate isomerase [Pseudomonas monteilii SB3078]
Sequence
MELYTYYRSTSSYRVRIALALKGLGYQSLPVNLLQGEQRGAGYVAVNPQGRVPALRTDGG
ELLVQSPAIIEYLEEVYPQPALLPATAEARAKVRGVAAIIGCDIHPLHNVSVLNRLRQAG
QDESQVNQWIGHWISQGLGAVEQLIGDHGFCFGDEPGLADVYLIPQLYAAERFNVDLDSF
PRILRVAALAAEHAAFAQAHPARQPDSPAQ
Download sequence
Identical sequences A0A059V593 F8G5X6 V9V597
gi|568183962|ref|YP_008956652.1| WP_013974186.1.23948 WP_013974186.1.28354 WP_013974186.1.35335 WP_013974186.1.56258 WP_013974186.1.65739 WP_013974186.1.7288 gi|568189335|ref|YP_008962015.1| gi|339489327|ref|YP_004703855.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]