SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568184043|ref|YP_008956733.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568184043|ref|YP_008956733.1|
Domain Number 1 Region: 317-339,368-756
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 1.76e-117
Family beta-Lactamase/D-ala carboxypeptidase 0.00018
Further Details:      
 
Domain Number 2 Region: 164-357
Classification Level Classification E-value
Superfamily Lysozyme-like 1.24e-66
Family PBP transglycosylase domain-like 0.00000498
Further Details:      
 
Weak hits

Sequence:  gi|568184043|ref|YP_008956733.1|
Domain Number - Region: 63-137
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0443
Family Tandem AAA-ATPase domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|568184043|ref|YP_008956733.1|
Sequence length 773
Comment penicillin-binding protein 1B [Pseudomonas monteilii SB3078]
Sequence
MTRTRNPRTPQKRPTGRSRAWLGWALKLSLVGLVIVAGFAVYLDAVVQEKFSGKRWTIPA
KVYARPLELFTGQKLSKNDFLTELDALGYRRESAANGPGAAAVNGNTVELNTRGFQFYEG
MEPAQFVRVRFSGDYVAGLSGANGKTLDVVRLEPLMIGGIYPKNLEDRILIKIDQVPPYL
LETLVATEDRDFYSHFGVSPKSIARAMWVNTSAGSMRQGGSTLTQQLVKNFYLTSERSLS
RKLTEAMMAVLLELHYDKREILEAYLNEVFVGQDGQRAVHGFGLASQFFFSQPLSELKLH
QIALLVGMVKGPSYYNPRRYPDRALARRNLVLDLVAEQGVASQAEVDAAKKMPLGVTKRG
SLADSSFPAFLDLVKRQLRQDYRDEDLTEEGLRIFTSFDPILQMKAETSMSETFKRLAGR
KGADEVESAMVVTNPETGEVQALIGSRQAGFAGFNRAIDAVRPIGSLVKPAVYLTALEQP
TKYTLTSWVQDEPFSVKGADGQVWRPQNYDRRPHGTIYLYQGLANSYNLSTAKIGLEVGV
PNVIKTIGRLGVNVDWPAFPAMLLGAGGMSPMQVATMYQTIANGGFNTPMRGIRSVLTAE
GEPLKRYPFQIQQTFDPGAIYLVQNAMQRVMREGTGRSVYNTLPRNLTLAGKTGTSNDSR
DSWFSGFSQDLLAVVWMGRDDNGKTPFTGATGALQVWTSFMKKADPLPLDMPQPDNVVQA
WIDLYSGHGSDGSCPGAVQMPYIRGSEPPAGATCGGEQDPVESVMDWVKGWMN
Download sequence
Identical sequences V9V6K6
gi|568184043|ref|YP_008956733.1| WP_024087752.1.23948 WP_024087752.1.28354 gi|568189416|ref|YP_008962096.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]