SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568184074|ref|YP_008956765.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568184074|ref|YP_008956765.1|
Domain Number 1 Region: 338-514
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.65e-53
Family G proteins 0.0000876
Further Details:      
 
Domain Number 2 Region: 627-753
Classification Level Classification E-value
Superfamily Initiation factor IF2/eIF5b, domain 3 4.45e-34
Family Initiation factor IF2/eIF5b, domain 3 0.0039
Further Details:      
 
Domain Number 3 Region: 748-844
Classification Level Classification E-value
Superfamily Translation proteins 1.32e-30
Family Elongation factors 0.0000655
Further Details:      
 
Domain Number 4 Region: 519-601
Classification Level Classification E-value
Superfamily Translation proteins 4.42e-26
Family Elongation factors 0.0096
Further Details:      
 
Domain Number 5 Region: 3-51
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.0000000000161
Family N-terminal subdomain of bacterial translation initiation factor IF2 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|568184074|ref|YP_008956765.1|
Sequence length 846
Comment translation initiation factor IF-2 [Pseudomonas monteilii SB3078]
Sequence
MTQVTVKELAQEVEAPVERLLQQMREAGLPHTDAGQVVTDNEKQTLLTHLKSSHKSKAEE
PRKITLQRKTTSTLRVAGSKSISVEVRKKKVFVQRSPEEIQAEQKRELEERRAAENAARE
KVEAEVRQRNEEQARRQAAETAAAAPAPAAKPEAAPAAAPAPVVADAPASEDAAARAAER
KKDEARRNEGRTRDEDRRGGERRGEAPRVSIKVKVKEKEKAPTPRAAPRTTDEESDGVRR
GRGGKSKLKKRNQHGFQNPTGPVIRDVTIGETITVSELAQQMSVKAAEVVKFMFKLGTPV
TINQVLDQETAQLVAEELGHKVTLVSDTALEDSLAESLKFEGEVESRAPVVTVMGHVDHG
KTSLLDYIRRAKVAAGEAGGITQHIGAYHVETDRGMVTFLDTPGHAAFTAMRARGAKATD
IVILVVAADDGVMPQTREAVQHAKAAGVPLVVAVNKIDKPGADIDRIRNELAVEGVTSED
WGGDTPFVKVSAKMGTGVDELLEAVLLQAEILELTATPTAPGRGVVVESRLDKGRGPVAT
ILVQDGTLRQGDMVLCGSNYGRVRAMLDENGKPVKEAGPSIPVEILGLDGTPEAGDELSV
VADEKKAREVALFRQGKYREVKLARAHAGKLENIFETMGQEEKKTLNIVLKTDVRGSLEA
LQGSLSGLGNDEVQVRVIGGGVGGITESDANLALASNAVLFGFNVRADAGARKIVEQEGL
DMRYYNVIYDIIEDVKKALTGMLGSDVRENILGVAEVRDVFRSPKFGAIAGCMVIEGTVY
RNRPIRVLREDVVIFEGELESLRRFKDDASEVRNGMECGIGVKSYNDVKVGDKIEVFEKV
QVARTL
Download sequence
Identical sequences A0A059V273 A0A099N4G1 A0A0C1HYJ2 V9V395
2035966897 gi|568189447|ref|YP_008962128.1| gi|568184074|ref|YP_008956765.1| WP_024087764.1.1643 WP_024087764.1.23948 WP_024087764.1.28354 WP_024087764.1.35335 WP_024087764.1.56258 WP_024087764.1.65739 WP_024087764.1.7288 WP_024087764.1.7435 WP_024087764.1.80759

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]