SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568184099|ref|YP_008956790.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568184099|ref|YP_008956790.1|
Domain Number 1 Region: 6-376
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 4.64e-99
Family FMN-linked oxidoreductases 0.00000113
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|568184099|ref|YP_008956790.1|
Sequence length 381
Comment L-lactate dehydrogenase [Pseudomonas monteilii SB3078]
Sequence
MIISASTDYRAAAQRKLPPFLFHYADGGAYAEHTLRHNVSDLASIALRQRVLKNMSELSL
QTKLFDETLSMPVALAPVGLTGMYARRGEVQAARAAAAHGIPFTMSTVSVCPIEEVAPAI
DRPMWFQLYVLKDRGFMRNALERAKAAGVKTLVFTVDMPTPGARYRDAHSGMSGKNGPLR
RVLQAMTHPEWAWDVGVMGRPHDLGNISTYRGNPTGLADYIGWLANNFDPSISWKDLEWI
REFWDGPMIIKGILDADDARDAVRFGADGIVVSNHGGRQLDGVLSSARALPAIADAVKGD
LKILADSGIRSGLDVVRMIALGADTVLIGRAFLYALAVHGQAGVKNLLELFEKEMRVAMV
LTGAKSISEITRDSLVRELGA
Download sequence
Identical sequences A0A059UXU4 A0A099N4I3 A0A0C1KT78 A0A0M2UQL0 A0A136QJ39 A0A1L5PW98 F8G6J3 L0FS76 V7DCA7 V9V3C1
2035966870 WP_013974303.1.1643 WP_013974303.1.23948 WP_013974303.1.28354 WP_013974303.1.35335 WP_013974303.1.36363 WP_013974303.1.52768 WP_013974303.1.56258 WP_013974303.1.57632 WP_013974303.1.59340 WP_013974303.1.65739 WP_013974303.1.71677 WP_013974303.1.7288 WP_013974303.1.7435 WP_013974303.1.76710 WP_013974303.1.80759 WP_013974303.1.95946 WP_013974303.1.98117 WP_013974303.1.99927 gi|431804535|ref|YP_007231438.1| gi|568184099|ref|YP_008956790.1| gi|568189472|ref|YP_008962153.1| gi|339489465|ref|YP_004703993.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]