SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568184117|ref|YP_008956809.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568184117|ref|YP_008956809.1|
Domain Number 1 Region: 189-291
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.000000000000549
Family Multidrug resistance efflux transporter EmrE 0.012
Further Details:      
 
Domain Number 2 Region: 45-146
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.0000000000772
Family Multidrug resistance efflux transporter EmrE 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|568184117|ref|YP_008956809.1|
Sequence length 306
Comment multidrug transporter [Pseudomonas monteilii SB3078]
Sequence
MPASRRFPLLLIGAFLALYLVWGSTYLFIRIGVESWPPMLMAGVRFLIAGGLLYGFLRWR
GVPAPTWPQWRAAGAIGFLLLSCGNGGVTVAEHAGVASGVAALAVATVPLFTLLFGLLFG
HRNSKLEWAGIALGLVGIGLLNLGSNLQASPIGAALIIFAAASWAFGSVWSKTLPLPQGP
MASAAEMLVGGAVLLLGSALSGERMTQMPTAAGWGALAYLVFFGSILAFSAYMYLLKHVR
PAAATSYAYVNPAVAVLLGIVFAGEQIGAEECVAMAVIIGAVVLIGLPQWRKAPEPSQPL
KGEICK
Download sequence
Identical sequences A0A2A3MBM3 F8G6L6 V9V5P9
WP_013974321.1.23948 WP_013974321.1.28354 WP_013974321.1.35335 WP_013974321.1.56258 WP_013974321.1.65739 WP_013974321.1.7288 WP_013974321.1.80759 gi|568184117|ref|YP_008956809.1| gi|339489488|ref|YP_004704016.1| gi|568189490|ref|YP_008962172.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]