SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568184157|ref|YP_008956849.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568184157|ref|YP_008956849.1|
Domain Number 1 Region: 8-276
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 9.97e-90
Family beta-Lactamase/D-ala carboxypeptidase 0.00000103
Further Details:      
 
Domain Number 2 Region: 276-368
Classification Level Classification E-value
Superfamily Penicillin-binding protein associated domain 5.89e-25
Family PBP5 C-terminal domain-like 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|568184157|ref|YP_008956849.1|
Sequence length 386
Comment D-alanyl-D-alanine carboxypeptidase [Pseudomonas monteilii SB3078]
Sequence
MNITNLAKRLCLPVLLMITPAAFAAEQMTPAPPQLAAKSYVLMDASSGNVLVENNGDERL
PPASLTKLMTAYIATLDIRRGQIGENDPVTVSENAWRTGGSRMFIKVGSQVTVSDLLHGI
IIQSGNDASVALAEHIAGSEDAFADMMNKTAADLGMANSHFMNPTGLPHPDHYSSAHDMA
TLARAIINVDPAHYAIYSQKEFFWNNIKQPNRNLLLWRDKTVDGLKTGHTDEAGYCMVAS
AVRDGQRLIAVVFGTNSEQSRAAETQKLLTYGFRFFETQTFYQKGTELTKSPVWKGATGE
VKAGLANDLTLTMPKGQLKRLQASMTMNPQLTAPIAKGDVIGKVEVKLDEKVVHSADLIA
LDGVEEGGFFRRMWDSIRLFFYGLFN
Download sequence
Identical sequences A0A059V2C6 A0A099N6X7 A0A0C1HYC1 A0A136QJE9 F8G6Q6 L0FS71 V7DA76 V9V5T5
gi|568189530|ref|YP_008962212.1| gi|431804621|ref|YP_007231524.1| WP_013974353.1.1643 WP_013974353.1.23948 WP_013974353.1.28354 WP_013974353.1.35335 WP_013974353.1.56258 WP_013974353.1.57632 WP_013974353.1.65739 WP_013974353.1.71677 WP_013974353.1.7288 WP_013974353.1.7435 WP_013974353.1.80759 2035966799 gi|339489528|ref|YP_004704056.1| gi|568184157|ref|YP_008956849.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]