SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568184164|ref|YP_008956856.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568184164|ref|YP_008956856.1|
Domain Number 1 Region: 9-216
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 4.07e-52
Family Adenylyltransferase 0.0000545
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|568184164|ref|YP_008956856.1|
Sequence length 219
Comment nicotinic acid mononucleotide adenylyltransferase [Pseudomonas monteilii SB3078]
Sequence
MSKAQAVRRIGILGGTFDPVHIGHLRSALEVAEFMGLDELRLLPNARPPHRDTPQVAAQD
RLAMVQGAVQGVPCLSVDARELARDKPSYTIDTLESIRAELAAGDQLFLVLGWDAFCGLP
GWHRWEELLQHCHILVLQRPDADVEPPDELRNLLAARSESDPTALSGPAGNISFVWQTPL
AVSATQIRQLLASGKSVRFLVPDAVLAYIEAHELYRAPN
Download sequence
Identical sequences A0A059V5H1 A0A099N4H8 F8G6R3 V9V3H8
gi|339489535|ref|YP_004704063.1| gi|568189537|ref|YP_008962219.1| gi|568184164|ref|YP_008956856.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]