SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568184174|ref|YP_008956866.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568184174|ref|YP_008956866.1|
Domain Number 1 Region: 13-322
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 1.03e-88
Family FMN-linked oxidoreductases 0.00000444
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|568184174|ref|YP_008956866.1|
Sequence length 337
Comment tRNA-dihydrouridine synthase B [Pseudomonas monteilii SB3078]
Sequence
MSAVRIGPYTLRNNLILAPMAGVTDQPFRTLCQRLGAGMVVSEMVSSDMSLWNSRKSSLR
RIHEGDPEPRSVQIAGGDAQMMAAAAKANVDAGAQIIDINMGCPAKKVCNKAAGSALLRD
EALVSEILHAVVGAVDVPVTLKIRTGWDRANKNGLNVAKIAEQAGIQALAVHGRTRADLY
TGEAEYDTIAAIKQAVSIPVFANGDITSPEKARAVLDATGVDGLLIGRAAQGRPWIFREI
EHYLRTGEHLPAPQLEEVERILLEHLAALHAFYGDVMGVRIARKHVGWYLATRPGGKEFR
SRFNALEDTQAQCANVRAFFSERRQSLETEDGQGVAA
Download sequence
Identical sequences A0A059V5H5 A0A0C1I861 A0A136QJI5 F8FSR5 V9V3I9
gi|568184174|ref|YP_008956866.1| gi|339489545|ref|YP_004704073.1| gi|568189547|ref|YP_008962229.1| WP_013974369.1.23948 WP_013974369.1.28354 WP_013974369.1.35335 WP_013974369.1.56258 WP_013974369.1.65739 WP_013974369.1.7288 WP_013974369.1.7435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]