SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568184211|ref|YP_008956903.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568184211|ref|YP_008956903.1|
Domain Number 1 Region: 185-283
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.00000000000000314
Family Multidrug resistance efflux transporter EmrE 0.018
Further Details:      
 
Domain Number 2 Region: 36-138
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.000000000000745
Family Multidrug resistance efflux transporter EmrE 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|568184211|ref|YP_008956903.1|
Sequence length 290
Comment membrane protein [Pseudomonas monteilii SB3078]
Sequence
MNYLFPLTAILIWAGNTVVTKMSAGAIHPAEIGFYRWLLAALLFTPFLLPAVWRNRAAIR
PHLGKVFVLGVLGMALYQSLAYFAAGITSATNMGIILSLMPLMSLALSIAWLGQRLSYGA
LLGALVSFFGVLEVVSAGHPASLLQQGLNSGDLLMLVATLAYALYSFLLKKWQMRLPPMQ
LLYLQVLVAIVVLLPLFLLSDKTGLNSRNVGLVLYACVLASMIAPLVWMQAVHRLGPSRT
TLFFNLLPLVTALIAAVVLDEQLARYHLVGGLLTLAGVVLAERWTTPIRR
Download sequence
Identical sequences A0A059V2G2 A0A2A3MBW3 F8FSV1 V7D8W2 V9V5C6
gi|568184211|ref|YP_008956903.1| gi|568189584|ref|YP_008962266.1| WP_013974401.1.23948 WP_013974401.1.28354 WP_013974401.1.35335 WP_013974401.1.56258 WP_013974401.1.7288 gi|339489581|ref|YP_004704109.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]