SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568184287|ref|YP_008956981.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568184287|ref|YP_008956981.1|
Domain Number 1 Region: 13-311
Classification Level Classification E-value
Superfamily Ribokinase-like 1.56e-59
Family Ribokinase-like 0.0048
Further Details:      
 
Domain Number 2 Region: 339-470
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 4.15e-25
Family Cytidylyltransferase 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|568184287|ref|YP_008956981.1|
Sequence length 473
Comment bifunctional heptose 7-phosphate kinase/heptose 1-phosphate adenyltransferase [Pseudomonas monteilii SB3078]
Sequence
MKLSMPRFDQAPVLVVGDVMLDRYWHGGTSRISPEAPVPVVKVDQIEDRPGGAANVALNI
AALGAPASLIGVTGQDEAADSLANSLQAAGVRSVFQRIAHQPTIVKLRVMSRHQQLLRID
FEEPFATDPLSLGAEVDSLLEGVKVLVLSDYGKGALKNHQSLIQAARAKGIPVLADPKGK
DFSIYRGASLITPNLSEFETIVGRCADEAELVAKGLQLLQDLDLGALLVTRGEHGMTLLR
SGQPALHLPARAREVFDVTGAGDTVISTLAAAIAAGEDLPHAVALANLAAGIVVGKLGTA
AISAPELRRAIQREEGSERGVLGLEQLLLAIDDARAHKEKIVFTNGCFDILHAGHVTYLE
QARAQGDRLIVAVNDDASVSRLKGPGRPINSVDRRMAVLAGLGAVDWVISFPEGTPENLL
SQVKPDVLVKGGDYGIDQVVGADIVKAYGGTVKVLGLVENSSTTAIVEKIRKN
Download sequence
Identical sequences A0A0C1KLT8 A0A0M2USL5 A0A2A3MB67 F8FU16 V9V6A8
gi|568189660|ref|YP_008962344.1| gi|568184287|ref|YP_008956981.1| WP_013974472.1.15314 WP_013974472.1.23948 WP_013974472.1.28354 WP_013974472.1.33515 WP_013974472.1.35335 WP_013974472.1.35716 WP_013974472.1.56258 WP_013974472.1.65739 WP_013974472.1.7288 WP_013974472.1.7435 WP_013974472.1.78427 WP_013974472.1.80759 WP_013974472.1.98117 gi|339489659|ref|YP_004704187.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]