SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568184317|ref|YP_008957013.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568184317|ref|YP_008957013.1|
Domain Number 1 Region: 161-325
Classification Level Classification E-value
Superfamily Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain 1.9e-57
Family GAPDH-like 0.00000728
Further Details:      
 
Domain Number 2 Region: 8-177
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 8.51e-52
Family Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain 0.0000455
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|568184317|ref|YP_008957013.1|
Sequence length 353
Comment glyceraldehyde-3-phosphate dehydrogenase [Pseudomonas monteilii SB3078]
Sequence
MPHLRPYKVALNGYGRIGRCVLRALFERGAKAGFEIVALNDLADQASLEYLTRFDSTHGR
FPGEVKVDGDCLHINGDCVKVMRSATPEGIDWAALDIDLVLECSGAYHTRADGQRFLDAG
APRVLFSQPMASEADVDATVVYGVNQACLTGNERLVSNASCTTNCGVPLLRVLDQAFGIE
YVQITTIHSAMNDQPVIDAYHHEDLRRTRSAFQSVIPVSTGLARGIERLLPELAGRIQAK
AVRVPTVNVSCLDITLQTARDTSAAEVNRVLREAALEGPLKGLLAYTELPHASCDFNHDP
HSAIVDASQTRVSGPRLVNLLAWFDNEWGFANRMLDVAEHYLHVVHPTRNKQP
Download sequence
Identical sequences A0A059V5T2 A0A099N552 A0A0C1IDF9 A0A0M2UR78 A0A1L5PX05 F8FU46 V7DBU0 V9V6D4 V9WZW4
gi|568189690|ref|YP_008962376.1| gi|339489689|ref|YP_004704217.1| WP_013974502.1.15314 WP_013974502.1.23948 WP_013974502.1.28354 WP_013974502.1.32670 WP_013974502.1.33515 WP_013974502.1.35335 WP_013974502.1.36363 WP_013974502.1.41505 WP_013974502.1.52768 WP_013974502.1.56258 WP_013974502.1.59340 WP_013974502.1.61620 WP_013974502.1.65739 WP_013974502.1.7288 WP_013974502.1.7435 WP_013974502.1.76210 WP_013974502.1.76710 WP_013974502.1.78427 WP_013974502.1.80759 WP_013974502.1.92076 WP_013974502.1.9402 WP_013974502.1.98117 WP_013974502.1.99927 gi|568184317|ref|YP_008957013.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]